PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID e_gw1.12.292.1
Common NameCHLNCDRAFT_23935
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family WRKY
Protein Properties Length: 177aa    MW: 19567.6 Da    PI: 9.913
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
e_gw1.12.292.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY90.21.6e-28461259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                    dDgynWrKYG K+vkgs+fprsYY+C+++gCp+kk +er+ + +++ +   ++eHnh 
  e_gw1.12.292.1  4 DDGYNWRKYGEKQVKGSPFPRSYYKCSHPGCPAKKMIEREPKTGRISQAELKNEHNHA 61
                    8********************************************************7 PP

2WRKY105.43e-33112170159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +dDgy+WrKYGqK vkg+++prsYY+Ct++gC+v+k+vers ++ +++++tYeg+H+h+
  e_gw1.12.292.1 112 MDDGYRWRKYGQKIVKGNPHPRSYYKCTHPGCNVRKQVERSGRNARMLVTTYEGTHTHD 170
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081125.075163IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.7E-25363IPR003657WRKY domain
SMARTSM007741.7E-29362IPR003657WRKY domain
SuperFamilySSF1182901.83E-23363IPR003657WRKY domain
PfamPF031061.5E-22460IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-3399172IPR003657WRKY domain
SuperFamilySSF1182901.7E-29107172IPR003657WRKY domain
PROSITE profilePS5081132.971107172IPR003657WRKY domain
SMARTSM007747.5E-39112171IPR003657WRKY domain
PfamPF031063.2E-27113170IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MANDDGYNWR KYGEKQVKGS PFPRSYYKCS HPGCPAKKMI EREPKTGRIS QAELKNEHNH  60
AKPGQRRRTP SAGVSPPADG AGPSGRRGSD AAEGGGGDER NVVELETDAD GMDDGYRWRK  120
YGQKIVKGNP HPRSYYKCTH PGCNVRKQVE RSGRNARMLV TTYEGTHTHD PPATTNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-304173878Probable WRKY transcription factor 4
2lex_A2e-304173878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00494DAPTransfer from AT5G07100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005847104.11e-130hypothetical protein CHLNCDRAFT_23935, partial
SwissprotQ9C5T32e-55WRK26_ARATH; Probable WRKY transcription factor 26
TrEMBLE1ZGV11e-130E1ZGV1_CHLVA; Putative uncharacterized protein (Fragment)
STRINGEFJ250337e-55(Selaginella moellendorffii)
STRINGEFJ300093e-54(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4691626
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.21e-54WRKY DNA-binding protein 26
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]